GenomeNet

>hsa:6419 SETMAR, HsMar1, METNASE, Mar1; SET domain and mariner transposase fusion gene (EC:2.1.1.43); K11433 histone-lysine N-methyltransferase SETMAR [EC:2.1.1.43] (A)
MFAEAAKTTRPCGMAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVG
PGADIDPTQITFPGCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNV
LCRCSDHCRNRVVQKGLQFHFQVFKTHKKGWGLRTLEFIPKGSSLYCPVEKSNISCGNEK
EPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPG
TANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVN
HSTVVRHLKQIGKVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKW
ILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKY
AQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDL
LPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCN
GSYFD

BLAST