GenomeNet

>hsa:79295 K04257 olfactory receptor | (RefSeq) OR5H6, OR3-11; olfactory receptor family 5 subfamily H member 6 (gene/pseudogene) (A)
MFLYLCFIFQRTCSEEMEEENATLLTEFVLTGFLHQPDCKIPLFLAFLVIYLITIMGNLG
LIVLIWKDPHLHIPMYLFLGSLAFVDASLSSTVTPKMLINFLAKSKMISLSECMVQFFSL
VTTVTTECFLLATMAYDRYVAICKALLYPVIMTNELCIQLLVLSFIGGLLHALIHEAFSF
RLTFCNSNIIQHFYCDIIPLLKISCTDSSINFLMVFIFAGSVQVFTIGTILISYTIILFT
ILEKKSIKGIRKAVSTCGAHLLSVSLYYGPLTFKYLGSASPQADDQDMMESLFYTVIVPL
LNPMIYSLRNKQVIASFTKMFKSNV

BLAST