GenomeNet

>hsa:9218 K06096 vesicle-associated membrane protein-associated protein A | (RefSeq) VAPA, VAP-33, VAP-A, VAP33, hVAP-33; VAMP associated protein A (A)
MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYC
VRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDE
LMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECK
RLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFI
GFFLGKFIL

BLAST