GenomeNet

>hse:Hsero_0163 K01834 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11] | (GenBank) gpmA; 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase protein (A)
MYKIVFMRHGESTWNLANRFTGWVDVDLTEKGVAEARQAGKLLKEAGFTFDLAYTSVLKR
AIRTLWTTLDEMDQMYIPIKNDWRLNERHYGALQGLNKAETAAQYGDEQVLVWRRSYDTP
PNPLTPGEERDAFGDPRYAGLSREQVPLTECLKDTVARVLPAWNDAIAPAIRAGKQIIIS
AHGNSLRALIKYLDGISDNDIVGLNIPNGQPLVYELDADLKPIKSYYLGDQSAIEAALKA
VANQGKSK

BLAST