GenomeNet

>hse:Hsero_0338 K01921 D-alanine-D-alanine ligase [EC:6.3.2.4] | (GenBank) ddlB; D-alanine-D-alanine ligase B protein (A)
MISQDQIKAFGRVGVLFGGRSAEREVSMMSGNGVLQALRSKGVDAHPFDPAERSLGELQA
EQFDRVFIALHGRYGEDGTLQGALEQMGLPYTGPGVMSSSIAMDKVMTKRIWLSHGLPTP
RFLTLDAQATTREQLRLVPDTLGLPLMLKAPHEGSTIGIAKVNGYSDMQEGFDLCARYDK
VVLAEEFIRGRELTVPVLGTGSAARALPVIEIRAPEGNYDYQNKYFTDDTKYLCPAPLDE
ELTRHLQNLAVQAFNALGCRGWSRVDFMLREVDGKAEPYLLEINTSPGMTGHSLVPMAAK
AVGMSYEDLCCEILQMAALDMTPSKDWTPQAGQS

BLAST