GenomeNet

>hse:Hsero_1165 K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] | (GenBank) sodB; superoxide dismutase [Fe] protein (EC:1.15.1.1) (A)
MAHTLPALPYDLDALAPTISKETLEYHYGKHHQTYVTNLNNLIPGTEFENLSLEEIIKKS
SGGIFNNAAQVWNHTFYWNGLTPKGQGAPSGALADAINAKWGSFDAFKAEFTKQGLANFG
SGWTWLVKKADGTLDIVNTTGAGTPLTTDSKPLLTVDVWEHAYYIDYRNARAKYVENYWG
IINWDFVAKNFA

BLAST