GenomeNet

>hse:Hsero_2278 K10747 DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7] | (GenBank) ATP-dependent DNA ligase protein (EC:6.5.1.1) (A)
MREFSRLYGELDATTSTTRKLAALEDYFGRADPADAAWAVYFLAGGKPRQAVPTSLLKQC
AMEYAQIDEWLFEECYQSVGDLAETIAHILPPASGSNPLGLARWVEERIAPLRGAAPETI
RAALFQAWDELDWQGRFLLSKLIGGGFRVGVSRLLVTRALAAVAQLDAKLVAQRMVGWTD
GRARPDAERFARLIAPADSADQPLQGGQPYPFFLAHPLMDAPATLGPIQQWQVEWKYDGI
RAQLVRRHGQNWLWSRGEELITERFPELAALPLPDGTVIDGEIVIRHPDAGLAAERVAPF
SELQKRIGRKNLSARLLAELPAGLIAYDLLEQDGCDLRGLPQSERRRRLEALVGSHPAAA
LMLAPTLTAKDWDALAQLRASARERGVEGMMLKDIDARYGIGRTRNDGTWWKWKIDPYSI
DAVLIYAQAGHGRRASLYTDYTFALWDGPPEAGSQRKLVPFAKAYSGLTDAEIAVVDQVI
RKSTIEKFGPVRSVQPSMVFEIGFEGIALSSRHKAGMAVRFPRILRQRLDKTVEQADTLA
TLRALLPPSPQPEQR

BLAST