GenomeNet

>hse:Hsero_2925 K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] | (GenBank) ppc; phosphoenolpyruvate carboxylase protein (A)
MATTNPTKRSARSAPSTSRSAGANPAATSITPSKPARGADKDAPLKEDIRLLGRLLGEVL
REQEGDEVFEVVETIRQTAVRFRRESDAKAGAELDKLLKKLTRDQTNSVVRAFSYFSHLA
NIAEDQHHNRRRRAHLLAGSEAQPGSVAYALSRLDDAGVSGAQVRNFLKEALVSPVLTAH
PTEVQRKSILDAEREIARLVAERDLPLTPRELRHNTELLRARIATLWQTRMLRYTKLTVA
DEIENALSYYRTTFLRELPALYEDIEAEIDSQFPARGKSRPTELPPYVQMGSWIGGDRDG
NPNVNAGTMQHALQRQSTVVFDYYLEEVHTLGAELSISTLMVDASPELLALAATSPDHSE
HRADEPYRRALIGIYARLAATARALGAINILRQEVGAAAPYETPEQCVAELDVLVSSLQA
HHGAALVKPRLAGLKRAVEIFGFHLATLDMRQSSDIHERVLADLFAKAQVEADYAALNEE
RKIALLLGELSRPRLLHSPYLEYSEQTDSELSILRAAREIRRRYGERAIRNYIISHTETL
SDLLEVLLLQKETGLLHIEGNQLRELELMVIPLFETIPDLRCAAEIMRGWLSLPQVKGLI
AKHGKLQEVMLGYSDSNKDGGFLTSNWELYKAENQLVELFNEAGVKLRLFHGRGGTVGRG
GGPSYQAILAQPPGTVNGQIRLTEQGEIIASKFANPEIGRRNLELLVAATLEASLMPTNA
DDKEARKLAEFERVMEELSERAYRAYRNLVYETPGFTDYFFAATPIAEIAQLNIGSRPAS
RKATQRIEDLRAIPWGFSWGQCRLLFPGWYGFGSAVSGWLEDAGNAKEAARRLATLRAMC
KEWPFFAALLSNMDMVLSKTDLAVASRYAGLVADRKLRNAIFGRITDEHERTSAMLSTIT
GSKERLAANPLLARSIKNRFAYLDPLNHLQVELIKRHRATVAAKRTPEERVQRGIHLTIN
GVAAGLRNTG

BLAST