GenomeNet

>hse:Hsero_4283 gst; glutathione S-transferase protein (EC:2.5.1.18); K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MQDTELDPVLSETLQKAGRHLPTLVIANKNYSSWSMRPWVAMVAFDIPFKEVRLLLDQAD
TAAEIARYTGSGRVPVLLDGDIAIWDSLSICEYLAEQFPDRHLWPARTDARAIARSICAE
MHSGFTGLRSAMSMDIRGRYPGQGRTAEAQADIARVCEIWEECLSQFGHHDFLFGDFSIA
DAFYAPVVMRFISYQVPLAPALQAYADRVREHPAVARWIAEALAEKEILPDHK

BLAST