GenomeNet

>hse:Hsero_4283 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) gst; glutathione S-transferase protein (A)
MQDTELDPVLSETLQKAGRHLPTLVIANKNYSSWSMRPWVAMVAFDIPFKEVRLLLDQAD
TAAEIARYTGSGRVPVLLDGDIAIWDSLSICEYLAEQFPDRHLWPARTDARAIARSICAE
MHSGFTGLRSAMSMDIRGRYPGQGRTAEAQADIARVCEIWEECLSQFGHHDFLFGDFSIA
DAFYAPVVMRFISYQVPLAPALQAYADRVREHPAVARWIAEALAEKEILPDHK

BLAST