GenomeNet

>hsl:OE3765F glpC; sn-glycerol-3-phosphate dehydrogenase subunit C (EC:1.1.5.3); K00113 glycerol-3-phosphate dehydrogenase subunit C [EC:1.1.5.3] (A)
MSDSESDSTTTTAENRFEPATPNVGEKFDPVALHDDTDDFDLRPESDSCYKCSTCDTNCP
VAEVDDDFPGPKFQGPEQWRLKEQSDDEDHEIDDSITECSNCMRCDSACPSGVSLSQMHN
TARGEYVDDQMSKRSLKYWRNRILANYRTSARIASTLPRLANAAMNFGPARWVMEKTLGV
TSEREFPAFATETFREWWQARGGAAASKERAQARRRERGEPVDADKKVAYFHGCYANYNT
PEVGQAMVRVYEHFGYEIVVPKQGCSGTPMFANGMLDDARRHADITVSSMSDLIEEGYDA
IASCTSCSMALRQEYPELFDIDGIETVASNTFEAVEYLRIHEPLRETVQSADIDGELADE
FAYHAPCHARSQGLDRQAVELFGDLDGVGIDDVGDSCSGISGTYGWKEEKYETSMEIGDD
MFDHMESAEGDTGLTECPTCAMQMEHGTGYEVRHPLELLEAALVD

BLAST