GenomeNet

>hsm:HSM_1758 K00112 glycerol-3-phosphate dehydrogenase subunit B [EC:1.1.5.3] | (GenBank) Glycerol-3-phosphate dehydrogenase (A)
MAMKFDVVIIGGGLAGLTCGIMLQQKGKCCAIINNGQSAMNFSSGSMDLLSQLPNGEKIN
SFEQGYDSLEEQLPNHPYCLFGKQHVLQKAKQFEQLIEKINLNVTGSYKQNHFRVTPLGG
LHRTWLSADCIPTMDLHDEHFGYQKITVLGIEGYHDFQPHLLAENLIQHPQFTHCSITTA
LLHLPELDQLRLTSREFRSVNISQLLEHRLAFRELVQEIKQASGDGEAIFLPACFGLDNQ
DFFNKLTLETGLNLYELPTLPPSLVGLRQHKKLKTYFEKLGGFILNGDKALRAVIEDQQV
KQIYTQLHQEHGIFAEHFVLASGSFFSNGLVSVFDRLLEPIFDVDMIGNSMIDIQNRLTW
TARRFSSPQPYQSAGVAINSRCQLKKSGQIIKNLYAAGNVIGGYNALELGCGSGVAVVTA
LTAADNIIEAQNRV

BLAST