GenomeNet

>hsw:Hsw_2975 K00693 glycogen synthase [EC:2.4.1.11] | (GenBank) glycoside transferase family protein (A)
MQVPVPTPEPIAPDALLVEVAWEVCNQVGGIYTVIRSKVPATVQAWDDRYCLLGPYFAHQ
AQGEFEPYDDYQLATLSDPFAGAVREMRKQGYDVQLGIWLVTGRPRVVLINPYQGYPQLG
RIKSDLWHHHHIPMPDNDDLLHQVVAFGELAKVFLQILAAEVVPPQRLVAHFHEWMTGVA
IPALRREQVPVHLVFTTHATLLGRYLAMNDPNFYDHLMQVEWQGEAQHFNIEPAVTMERA
AAHGAHVFTTVSELTVRECIYLLDRIPDAVLPNGLNIERFVALHEFQNLHQQYKSKIHEF
VMAHFFQSYSFDLDKTLYLFTSGRYEYHNKGFDITLEALARLNYRLQQSGLEGNVVMFFI
TKRPFHSINPQVLQSRAVLEEVQATCEAIEQQVGERLFYAAAASTDHRLPDLSSMVDDYW
KLRYRRTLQSWKTTNLPPVITHNLVDDAGDDILNFLRRSNLVNNQHDRVKIVYHPDFVSP
TSPLFGMEYGQFVRGCHLGIFPSYYEPWGYTPLECVARGVPAITSDLSGFGDYVMQTVPG
HEDKGIFVVQRQEKSFDEAAEELTDMLWDFVQLTRRERIMQRNNVESSAELFDWKNLRVH
YDRAYQLALERQ

BLAST