GenomeNet

>hsw:Hsw_2975 glycoside transferase family protein; K00693 glycogen(starch) synthase [EC:2.4.1.11] (A)
MQVPVPTPEPIAPDALLVEVAWEVCNQVGGIYTVIRSKVPATVQAWDDRYCLLGPYFAHQ
AQGEFEPYDDYQLATLSDPFAGAVREMRKQGYDVQLGIWLVTGRPRVVLINPYQGYPQLG
RIKSDLWHHHHIPMPDNDDLLHQVVAFGELAKVFLQILAAEVVPPQRLVAHFHEWMTGVA
IPALRREQVPVHLVFTTHATLLGRYLAMNDPNFYDHLMQVEWQGEAQHFNIEPAVTMERA
AAHGAHVFTTVSELTVRECIYLLDRIPDAVLPNGLNIERFVALHEFQNLHQQYKSKIHEF
VMAHFFQSYSFDLDKTLYLFTSGRYEYHNKGFDITLEALARLNYRLQQSGLEGNVVMFFI
TKRPFHSINPQVLQSRAVLEEVQATCEAIEQQVGERLFYAAAASTDHRLPDLSSMVDDYW
KLRYRRTLQSWKTTNLPPVITHNLVDDAGDDILNFLRRSNLVNNQHDRVKIVYHPDFVSP
TSPLFGMEYGQFVRGCHLGIFPSYYEPWGYTPLECVARGVPAITSDLSGFGDYVMQTVPG
HEDKGIFVVQRQEKSFDEAAEELTDMLWDFVQLTRRERIMQRNNVESSAELFDWKNLRVH
YDRAYQLALERQ

BLAST