GenomeNet

>hte:Hydth_0928 K04565 superoxide dismutase, Cu-Zn family [EC:1.15.1.1] | (GenBank) superoxide dismutase copper/zinc binding protein (A)
MGGLSCLSSGMALCAVLFSFSIAQELKAHADIVNQKGEKIGKAELIQTNSGVLIKLEASN
LPPNAELAFHIHELGKCDPPDFMSAKGHFNPFKKKHGLLNPDGPHAGDMPNVFTDANGNL
KVHVLNTFVTLERGKENSLLKDGGTALMIHHHRDDYRTDPAGDAGARIACGVIK

BLAST