GenomeNet

>hvo:HVO_0113 phosphoglycerate mutase family protein (EC:5.4.2.1); K01834 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11] (A)
MSAPPTTVVSFVRHAHVPSVSDAERTPGLSRHGRRDAARVTARLADLADVVATSPAERAR
ATVEGVADAADAPLIVDDDLRERELADSPIEDFDEAVEHLWANPNASHPGGESHAEAQAR
GVAAVDRLVEAYPDRHVVVGTHATLMALVFNAYDPRYGREFWTGLTTPDVYEVTFVDSEA
FSIARTWTPEEAAREGDADRDPAER

BLAST