GenomeNet

>hvo:HVO_0113 K01834 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11] | (GenBank) putative phosphatase (histidine phosphatase family protein) (A)
MSAPPTTVVSFVRHAHVPSVSDAERTPGLSRHGRRDAARVTARLADLADVVATSPAERAR
ATVEGVADAADAPLIVDDDLRERELADSPIEDFDEAVEHLWANPNASHPGGESHAEAQAR
GVAAVDRLVEAYPDRHVVVGTHATLMALVFNAYDPRYGREFWTGLTTPDVYEVTFVDSEA
FSIARTWTPEEAAREGDADRDPAER

BLAST