GenomeNet

>hvo:HVO_0970 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (GenBank) rbcL; ribulose-bisphosphate carboxylase large subunit (EC:4.1.1.39) (A)
MGITYEDFLDLDYEPTDEDLVCTFRIDPATGMSTEAAASRVASESSNGTWAALQTGADFT
DMGATTFDIDGDLIRVAYPAGLFEPGNMPQVLSCIAGNIMGMKAVDTIRLLDCEWPESVV
SAYPGPLYGSSVREEIFGVTDRPITATVPKPKVGLSTAAHAQVGYDAWVGGVDLLKDDEN
LTDQAFNPFSDRLTESLSLRDDAEDETGEKKSYLINVTADTQTMLDRVDEVAAQGGEYVM
VDIITAGWAGLQTVRERTEKHGLAIHAHRAMHAAFDRLPAHGVSMRVLAQVSRLCGVDQL
HTGTAGLGKLANEDTVGINEWLAGDLHGATDVLPVASGGLHPGLLPDLLDATGTNVCVQL
GGGIHGHPDGTRAGAVALRSAIDAYVEGRAITEAAEETPELAVALDKWGTETPR

BLAST