GenomeNet

>hvo:HVO_1540 K00113 glycerol-3-phosphate dehydrogenase subunit C [EC:1.1.5.3] | (GenBank) gpdC1; glycerol-3-phosphate dehydrogenase subunit C (A)
MSDAESPGNPTLTPDAQTDDFEAVEVFPDSTDMDLRPGADNCYKCTACDVSCPVAEVDDE
FPGPKFQGPEQWRLKRKEDEAVDDSIMSCSNCMRCDDACPSGVPLSQMHNTARGEYVDEQ
MDKLSREYIRNRILANYGTLAQLGSMFPRLANAVMGNSVVQRINEKVLGITAERDFPEFA
TQTFREWWNERGGPQVRSDEKRVAYFHGCYSNYNTPEVGKAMVRVFESFGYEVVVPKQRC
SGTPMFANGMLDDAKRAAGINVDNFAGLIPEGYDIIASCTSCSMSLRQEYPELFDIDGIE
DLSAHTYEALEYLRIHEDLEGAVREASVDDQAFAYHAPCHGRNQGLDRQAVELFRQLDGV
EVEDVGDSCSGISGTYGWKEEKYDKSMQIGADMFDHMEHAQGSVGMTECPTCSMQMEHGT
GYDIKHPLQLLEEALV

BLAST