GenomeNet

>hvo:HVO_A0269 gpdA2; glycerol-3-phosphate dehydrogenase subunit A; K00111 glycerol-3-phosphate dehydrogenase [EC:1.1.5.3] (A)
MSYSVVVIGGGATGTGTARDLAMRGFDVTLVERGNLTEGTTGRTHGHLHSGARYAVSDKE
SAVDCMRENRVLHRIAGHCIEDTGGLFVQLEGDSDDYFERKLAGCAECDIPTEVISGEEA
RRREPYLTDAVERAIWVPDGAVDPFRLCVANAASAVEHGARIETHAEVVDLVVEGGRVAG
VEVKRQGPNHHSEGAAGDTETFEADYVVSATGAWAGQLAAMAGVDLEMAISKGAMVVTNV
RQLDTVINRCLPKGEGDTIIPHETTVLLGANDDPVDDPDDYPEEQWEVDMMIDIASEMVP
VVADARMIRAYWGVRPLYDPNPKSTTDPGDVTRNYFVLDHAERDGVAGFASVVGGKLTTY
REMAESVSDHVCEVLGVEEPCRTDEVPLPGSADPSALDEYMDEFDLRSPIARRSGQRLGD
RAPEVLDIDEPNPTLCECEAVTRAEVRDAIDQVGADLNGVRLRTRASMGNCQGGFCSHRL
GAELYPDHGAEVARDAVDELYQERWKGQRHALWGEQLSQAMLNAMLHATTMNHDANHVAG
DENIEYRAFDGGRTAVPEGSHGD

BLAST