GenomeNet

>hwc:Hqrw_1857 glpA1; glycerol-3-phosphate dehydrogenase subunit A (EC:1.1.5.3); K00111 glycerol-3-phosphate dehydrogenase [EC:1.1.5.3] (A)
MVSKPHIVVIGGGSTGTGIVRDLAMRGVEVTLLEQGNLTHGTTGRMHGLLHSGGRYAVAD
QASAKECMLENRVLQDIATHCVEMTGGLFVKRPEDSEEYFQKKLQGCHECDIPAEVLTAE
EARAVEPHLAGDIDKAISVPDGAIDPFRLVVANAADAKEHDARIETHSTVTDLLIEDDAV
VGVEVKHDSGTGERVHGMTGVTERIYADHVINATGAWAGHIGEMAGVDIAVRPSKGVMTV
MNTRQVDTVINRCRPKGDADIVVPHETTAILGTTDVEVDDPEDYPEKQWEVDLMIDTLSE
LVPMLTDARTIRSFWGVRPLYEPPEVGSDDPTDITRDFFLLDHQERDNLHGLTSIVGGKL
TTYRMMAEQITDHICERFGIEEPCRTADEPLPGSNDIRVIDDYMDEFGLRSPIGRRSADR
LGSRVDEVFDTDEPNPTICECEGVTRAEVQDAISQSGSDLNAVRIRTRATMGNCQGGICS
HRLANELHTTYDESVVIDAWNEILQERWKGQRHALWGQQLSQAMLNYALHATTQNRDHDP
AADSSVDFTTFDSGEMQSDSGTTAVGVATDGGTQDGDRV

BLAST