GenomeNet

>hya:HY04AAS1_0647 no KO assigned | (GenBank) DNA ligase D, 3'-phosphoesterase domain protein (A)
MSDYSKKRDFSKTPEPRWSVIESHESIFVIQEHHASHLHWDFRLALDGVLKSWAIPKEPP
IESGVKRLAIQTEDHPLEYANFEGVIPEGQYGAGVVKIWDKGTFELLERTDKKYDFILNG
NKLKGKYHLIKFPKGGDNAWLFFKSD

BLAST