GenomeNet

>hya:HY04AAS1_0647 DNA ligase D, 3'-phosphoesterase domain-containing protein (A)
MSDYSKKRDFSKTPEPRWSVIESHESIFVIQEHHASHLHWDFRLALDGVLKSWAIPKEPP
IESGVKRLAIQTEDHPLEYANFEGVIPEGQYGAGVVKIWDKGTFELLERTDKKYDFILNG
NKLKGKYHLIKFPKGGDNAWLFFKSD

BLAST