GenomeNet

>ica:Intca_0420 coagulation factor 5/8 type domain-containing protein; K01186 sialidase-1 [EC:3.2.1.18] (A)
MHTRRAALAGLALTVSIPLTVPLSVPVAMAGAAAATAADQTGITRTDLDHTGDGYPVYRI
PALTKTTDGTLVAAYDGRPSYGDVPNNIALVVRRSTDDGSTWEDRQVVRYEAGKPGFGDP
SLVTDRVTGRIWLFHAASVNQGYFGSTTGTDDADPNVLHADVSWSDDDGLTWQHRRLTSE
VKDPQWGGLFAASGEGIQIRRGPHQGRLVQQYAIRYQGGNWAASLISDDHGETWRFGDLL
GPGMDENKVVELSDGRLMLNSRAPGGYRKVAYSSDGGETWSGLHADDELVDPQNNGSIIR
YDADAAPSSPDAAKLLFSNTATQSGRRNLTIRQSCDNGETWPIRKVVEPGAAEYSTLTPL
GDQQFGLLYERGGYQHISFARFGGDWLDGVCAPLTSRTVTAGSPGGTAEVEVKVTSQETG
AIDGGRVALDLPSGFTAPEVPVAKLSRGATATVRIPVRMPEGAVTNAYPYTARFLSDKGS
SQSGGSIVVKGGNVVLSDSTERSYDGATITDLTDRVDAVKDLTGGAVTVRFSTTARPAVG
TLLSLADPISAVRDVIVSLNGGRPYVEVRTATSTYPIRLQSSVDVADGKVHELIAASNAG
VTSLILDDAVIAQVDGQGFFADVTALTRPHTLNPSGKPNLTLGMNRGHFSVNGGPAAPNS
RWGFVGTIHSVEVSDDLRTGEELVPAAGLSIASVSSEETAGEDGRAANAVDGNPATIWHS
KWTGTAAEYPHQITVDLGQAQPLTALRYLRRAVGTNGDIADHVVSVSDDNVSWTQVATGT
FAATKGEEEVRFAPQTARYVRLEALSAVNGLQFAAAAELRPVRTS

BLAST