GenomeNet

>ica:Intca_1898 no KO assigned | (GenBank) DNA polymerase LigD, polymerase domain protein (A)
MAAAKQTPALVLDVDGYDVRLTNPDRVYFSEGGQTKLDLANYYLSVGPGIVNALRDRPCM
LHRFPKGVEGPKVHQKRLPAGAPPWVETVRLHFPRFGLHADELCVQRLADVIWAVQMSTV
EFHPWNSRRADTEKPDEWRIDLDPMPRCGYDTVRRAAHVSREILGELGAVGWPKTSGGRG
LHIYVRIAPVHGFQDVRRAALAFAREVERRLPDDVTTAWWRRDRAPDDLFVDYNQNARDH
TIAAAYSVRGNSRGTVSAPVTWDEIDDAVPDDFTIATMPDRFARLGDLHAGIDDAVFDLA
PLLEWAERDERAGQDTPPEPEE

BLAST