GenomeNet

>ica:Intca_1898 DNA polymerase LigD, polymerase domain-containing protein (A)
MAAAKQTPALVLDVDGYDVRLTNPDRVYFSEGGQTKLDLANYYLSVGPGIVNALRDRPCM
LHRFPKGVEGPKVHQKRLPAGAPPWVETVRLHFPRFGLHADELCVQRLADVIWAVQMSTV
EFHPWNSRRADTEKPDEWRIDLDPMPRCGYDTVRRAAHVSREILGELGAVGWPKTSGGRG
LHIYVRIAPVHGFQDVRRAALAFAREVERRLPDDVTTAWWRRDRAPDDLFVDYNQNARDH
TIAAAYSVRGNSRGTVSAPVTWDEIDDAVPDDFTIATMPDRFARLGDLHAGIDDAVFDLA
PLLEWAERDERAGQDTPPEPEE

BLAST