GenomeNet

>ica:Intca_3052 K13953 alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1] | (GenBank) Alcohol dehydrogenase GroES domain protein (A)
MGTMQAAVVHAFGEDLSIDTVTIPTPGPGQALVKLVTSGVCHTDLHAAQGDWPVKPNPPF
IPGHEGVGEVVALGDGVTNLHVGQLVGNAWLFSACGECEYCNTGWETLCEKQQNGGYSID
GSFGQYMLVDARYAAIIPEGADPVEVAPVLCAGVTVYKGLKMTETKPGQWVVISGIGGLG
HVAVQYARAMGMRVAAVDIADDKLALAKQHGAEVVVNALEGDPGEAILAQTGGAHGVLVT
AVHPSAFGQAIHMTRRGGTIVFNGLPAGDFPASIFEIVLKGLTVRGSIVGTRQDMTEALD
FYARGLIHPTVATRELGDINAVFDEMKHGKIDGRVVIQY

BLAST