GenomeNet

>ica:Intca_3526 DNA primase small subunit; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MPLGSVAIEGAGGAGQVLHTRLSGGRARTSVPRGVSPAAYDRPVSAKPAVIEVPAPDGTV
RDVRISSPDRVLWPASGMADAQPVTKLDLAEYLLAVGDPLLRALGDRPVTLQRFPEGIEG
EEFFSKNPPKGVPDFTRTVMCTYPSGRKHLQLVIDEVASAMWAVQMNAITFHPWPVRTGN
VDNPDELRIDLDPQPGRGFRDAVEAAVALREVMAEIGLTAWAKTSGNRGVHVYARIAPTH
EFLDVRHGVIGIARELERRLPDLVTTSWWRRSGASASSSTSTRPAATGPSPRPTRPDRCR
ARPCPRRSRGRSCPTPTRGP

BLAST