GenomeNet

>ica:Intca_3526 DNA primase small subunit (A)
MPLGSVAIEGAGGAGQVLHTRLSGGRARTSVPRGVSPAAYDRPVSAKPAVIEVPAPDGTV
RDVRISSPDRVLWPASGMADAQPVTKLDLAEYLLAVGDPLLRALGDRPVTLQRFPEGIEG
EEFFSKNPPKGVPDFTRTVMCTYPSGRKHLQLVIDEVASAMWAVQMNAITFHPWPVRTGN
VDNPDELRIDLDPQPGRGFRDAVEAAVALREVMAEIGLTAWAKTSGNRGVHVYARIAPTH
EFLDVRHGVIGIARELERRLPDLVTTSWWRRSGASASSSTSTRPAATGPSPRPTRPDRCR
ARPCPRRSRGRSCPTPTRGP

BLAST