GenomeNet

>ipa:Isop_0204 hypothetical protein (A)
MPRFAILEHDWPTLHWDILLESGPALRTWAASAPPGHDSPAVVTVAVAEAVKEARGLEGI
DSLSLVYALPDHRLAYLDYEGPVSNQRGRVVRFDSGAFAIRLWNDFQVVAALRGDRLRGV
LTLVRLDRPRHSRGHPWGLAWSPSDLLPSTAPTPRHPVG

BLAST