GenomeNet

>ipa:Isop_0204 no KO assigned | (GenBank) hypothetical protein (A)
MPRFAILEHDWPTLHWDILLESGPALRTWAASAPPGHDSPAVVTVAVAEAVKEARGLEGI
DSLSLVYALPDHRLAYLDYEGPVSNQRGRVVRFDSGAFAIRLWNDFQVVAALRGDRLRGV
LTLVRLDRPRHSRGHPWGLAWSPSDLLPSTAPTPRHPVG

BLAST