GenomeNet

>ipo:Ilyop_1552 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) dethiobiotin synthase (A)
MHFLLTEGMGWIEVITGGMFSGKSEELIRRLIRSKYASQKVVAFKHSIDKRYDESNVVSH
SSIFIEGVPAASVKEMEKIFYEKYSDAEVIGIDEVQFFGEPVVEFCEKLSDMGKRVIVAG
LDQDFRGEPFEPIDSLLAKAEYVDKLSAICAVCGNPASRTQRLVNGEPAYYNDPVVLVGA
SESYEARCRKCHVVKREDNKEGKLYFIVGTDTDIGKTYAGLKLVKQEMDKGLKVTAIKPV
ETGSETFPENLEGSDSYAYARLLGKNVEDVNIFFYKKPMSPDAAAEADETSVDIKTIKEK
IDKELLENDVVFVEGAGGLLVPFVENYMYLDLLVDYRKKSEVILISGNVLGTINHTLLTI
DVLKRNDIKIKGVVFNNKENIEDKKFLKNNVETVKRIGKVEILAENEYGE

BLAST