GenomeNet

>ipo:Ilyop_1552 dethiobiotin synthase (EC:2.7.1.21 6.3.3.3); K00857 thymidine kinase [EC:2.7.1.21] (A)
MHFLLTEGMGWIEVITGGMFSGKSEELIRRLIRSKYASQKVVAFKHSIDKRYDESNVVSH
SSIFIEGVPAASVKEMEKIFYEKYSDAEVIGIDEVQFFGEPVVEFCEKLSDMGKRVIVAG
LDQDFRGEPFEPIDSLLAKAEYVDKLSAICAVCGNPASRTQRLVNGEPAYYNDPVVLVGA
SESYEARCRKCHVVKREDNKEGKLYFIVGTDTDIGKTYAGLKLVKQEMDKGLKVTAIKPV
ETGSETFPENLEGSDSYAYARLLGKNVEDVNIFFYKKPMSPDAAAEADETSVDIKTIKEK
IDKELLENDVVFVEGAGGLLVPFVENYMYLDLLVDYRKKSEVILISGNVLGTINHTLLTI
DVLKRNDIKIKGVVFNNKENIEDKKFLKNNVETVKRIGKVEILAENEYGE

BLAST