GenomeNet

>isc:IscW_ISCW005314 hypothetical protein; K06101 histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43] (A)
MEDVGGSATEDNICGGARNASRSPQGAKVHLGTTPPEQPQDPLKLRIAARRVAKAQDGSP
AGSAAAAADAAGSAAVRLRIKQRKSRRRRRSRSPPGKCGAADGGGKPRCSCMGSRIGKVG
SSSSSSDSESSCSVSDYSTCRTPRKADPCLPRREEPRRTPPLLSPTKLVPASIADARLRD
SADIAKGTEEGAKPSPVGTALTNDGGAVEHPLPYLSVDAPANVSPDSGIQSCGESPQRIV
GCQDDAPGFHGDEPHPYKSPHFALHDDLRPSDKTEPLKSGRTDGEGASCVDSAVQPLRVC
ASQKVGFRNDPSERTSPPLDIECKMADAEAAKELPSSPPRCASTTTAASPKTLPNIGSSA
KDGFSDRTVDDRVDLTKVADVVLPSPSERLRSKGAEKEAPKDASAVSPPRLRSRKEGEAP
CKPTERLSGAKTRVKGASAPLSRSGRASRSAASKTSSRKSGRLECGDSELHQLVQRVQDS
ICTQFQESMGASSDFEVGADLCGGDCIEMEEPRPKDEVTEVDEPKEMSKKTEHVSSKTVE
EEERKERKEETKAEEKPVPRKRGRPPRSDKTRRAVKVEATTSRQRRRHASKEDVVTSKAT
TDRKVPPKELDSKPDVNAIESRYRKEPRKSTSTDCRVKSSSRKTEEISKEAETPHDSLPR
EDGGDESVDIDALLHECSIEEQTHLLHMYQRKMKKKRFVQQPSRRNRRGGLRKSSSRACR
ESESCASIDALVEALSSAFISKQTTVPKTDAVPSIFRIVKYLRPKRSSERPLRQSVSMAK
TELRKTEKEEAKAAPAKKGKPKKQTQPSPAVPESSPELQTPPSGDRCLPLKKRHCLLSDE
KSSTEEKEPKPPNASAERNHGKQTTAAPTEVPAKKTSEAAETPCPPRSCETPVLTKAAKK
ALFPIVPSKPPCPEPKAPKKKKKARGKKQRPHPRTKRTSGNGNDDGRVPASSTSVDEAIE
SCVQKFADSAKSSEESRSRSRSRSPHAAEEARRSDDSEAVTLVEDDSDPDNPLKKISLLK
QKQQKLLKAVERARRSKEKQNEASPAGDDPAQTGKRHRKRKMRNRTGFVKVKRKRVAAQK
APVAAAAAASDYKFDLEEKDSCEDVSMKEDDAAEDVGSVQTGVHQPEVDEKAKVASKKSV
KGRGRRKGRKKKIVCKPAKKMAIEKKAASPEPAVKASATEVELAKVPAPDPAPDSSPDLA
KPAAAVVDTIAEAIEAVVARAKKVASVPSAKGKVKAKVEAIAVAAAKRKEAPQKEVVHPK
KKAIKSKEASAPTSTPTLSAAASSDAASTSSAASSASGVAGGSKPPKKKCKLDSASHKAA
SPINGGPPLPENTPVVTVTKPSCGGGAQHGTRRRRRREHQLPKKKYLKAGLYSSSFKEDG
EPSKEESPPPEEKSGGLMPSPIHAGKYLRQRRADFQLCYDIWWLHKHKQLLFSYDPVNNY
KRIKSVNGVYRVGLFSLKDIPANTEICYDYNFHNFNNERQQECKCGSDQCRGFIGGKSQR
LNGQAKEKDKAKEGAKGTSSRSVRKRQRERLRHRRDGKPEGVTTVASSSARLGPLQLKPL
SHQQRCFVQKHRCFLLRNYDRAKRSPPKPLRDRGKHCQHQAGPSPPAQHPQPPGEEEEGE
AFRTQFTALNTSRSVRTRQLARAQENTQLARTARLAQVFRDICSSVLACKDDNGKVLSTP
FVNLPSKRKCPDYFEKIHTPIDLNTIEKNIITGEYKDLETFAADFNLLFDNAELYHKENV
DLVSSLGKLRRCYEEAKYLVVPILEDILGEPVPSHFTTYSSTNEKPAEEDEEVIRCVCNI
FKDEGLMIQCEKCFVWQHCDCMGVNGDIENYLCELCNPREVCLEIPLGPPVQNGGYQSFL
TLLKGTLQVRQGDCVYLAKDKSPLKPLSQEVRSERSRRSADAAGDPDEAEEAEPENSLDI
FRVERLWKNERQVLFNCCHSRVWGEKFLFGHHYLRPHETFHEPTRKFFHNEVLRIPLYEI
VPLECVVGTCCVLDLATYCRGRPRGCAEKDVYVCECRVDKGARLFYKITKPKYPVCTKSY
AFDVFETKLTPKRTYSPRSVPVVYQKRSRTRVAGFADTSSADREVKKERLDKVVRRLAAS
AATEKTSEILEATR

BLAST