GenomeNet

>isc:IscW_ISCW005573 K01283 peptidyl-dipeptidase A [EC:3.4.15.1] | (RefSeq) angiotensin-I converting enzyme, putative (A)
RMVSHAHAETYGMPCAPKVRPSALSLQIEQSLVSGALYKEVWKNMTQFKWTTFKDEQTRT
IFRRFSTLGTSLLPEDKQKEYLKIVADMKGNHAAAKICPFHRMTNQSDECNVPLEPTIKN
ILQDSRDYDELLHVWNEWRRVSGRPLKAQYSRYVELQNEAAKINGFDDASGMWQESYECE
DFEESIDQLWEQLQPLYKELHAYVRARLHALHGDKVREDGPIPAHLLGQIHSQQWNSLYK
FTQPFPGKPTVDVTDAMLKMNMTPTEMFKLSEKFFTSMGLPPMPDSFWEKSVLEKPTDRE
IVCHASAWDFCGSGDVRIKQCTQVKMDDLLVVHHEMGHIEYDLNYAKQPYYFRAGANPGF
HEAIGDTISLSVATPKHLKAVGLLEQSPEDTETGINYLYKIALDKVAGIPSMYVYDRWRW
NVFKGKYQSEQLNKGWWDLLLKHQGICPGVARTPEDFDPPSKYHISASVPYIRYFASTVL
QFQFYKALCEEANHKGPLHECDFYQSKEAGKLF

BLAST