GenomeNet

>isc:IscW_ISCW013869 protein-glutamine gamma-glutamyltransferase, putative (EC:2.3.2.13); K05619 transglutaminase 1 [EC:2.3.2.13] (A)
MDGRAESVVQVKSVDLHVSQNAKKHHTDDFDLSKGEHPILIVRRGDPFKVTVELNREYNP
DKDALAFVFTVKDEETPSYTKNTVAVVPVGYRSPNEVFGITSWAALIQSTLDKSLDIEIT
PPVNVIVGDWVMDIDSKIRNDDEFGYRYTHKDPIYILFNPWCRADTVYMDDTRMKFECVL
MDTGLIWRGNHTRLRPTVWKYGQFDKNVLECCVYLLRHVGKFATQSRSDPVKVSRHISAV
VNEANEGGVLYGSWKTSFPNGTHPAAWTGSAAILQQYLKSKKPVKYAQCWVFSGVTTTGS
SFDSFAVACSNFHVWNEVWMTRPDLEPGDYSGWQAIDSTPQEASDGVLRCGPASVKAIKR
AEILKPYDGTFIFAEVNADEIYWRYQGPMQPLKLISKTTDQIGRSISTKAAGRFEREDIT
DNYKYPESTAEERNAMLKALRKCNHAYSRYYLNDDMEDVGFDFELVDDIVIGSPFTVKLK
VTNKSPTKNYTAHVIIRVEAVHYTGNKKKQVKDESYEVHLKPNSKEEVGMLVTYEEYEKA
LLDQALFNISTLATIKETKFEYFAQDDFRVRMPDVKIEIEGEPSVNKQLNVRASFKNPLP
KPLNKAYFVIEGPGLSKPLRLLPHKQKIAPGEEARVSFQLVPESAGPKAIIAKFFSKELD
DVDGFKAVDVTDTTFAQPTNSITVTATA

BLAST