GenomeNet

>isc:IscW_ISCW019478 K05619 transglutaminase 1 [EC:2.3.2.13] | (RefSeq) hemocyte protein-glutamine gamma-glutamyltransferase, putative (A)
GPNPELSKGTFMSLRVPAQKGEFRLAPASWEVRVTHHDRAVLSIQVFVPAGVSVGSWKLS
VLGRSKNDPEAKSKFRLDKDVYILFNPWWSSMTWARSTWAPGSSHRVDDGFLDRFVSPNR
SRKLVNSYEHEETKPPLLRPQFGELVLPACTLLLEKSKLTYAARANPVKVVRAISAMVNS
ADDDGLITGNWSGNYDDGTAPWMWTGSSAILEQYVKTAGESVKYGQCWVFAGVCNTVCRA
LGIPSRPVTCYASAHDTDESITIDRYFDKEGEELKKYSRDSICTMLSSVRNFHVWNEVWM
ARRDLPPGYGGWQAIDATPQETSDGFYQVGPCSVAAVKRGEIGYMYDSPFVFAEVNADIV
HWKEDPSSTFGWERSKTLTYHIGLGVLTKKANMSVQEGMEDAEDITASYKCKEGSEEERM
AVLNAARSGGLSILFDLPSARNEDVTLKLQDIESVMIGQPFSVTVSMRNESNEQRTVSAV
LSASSVYYTGIIARKIKRDKATFVLQPQDEEVLSLTVEPREYLDKLVDFAMVKIYVIANV
KETRQTWSEEDDFTVTKPRLSIEIDGNTKVGQPFRATMRFQNPLDVELQDCTLSVEGPGI
TSAHVVHLPNVPAHGEWVHRETLVPKRAGSRNVVAIFNCRELFDVEGSVETVVQE

BLAST