GenomeNet

>isc:IscW_ISCW023206 hypothetical protein; K09188 histone-lysine N-methyltransferase MLL3 [EC:2.1.1.43] (A)
MTTSMPSGMGPNTVSNAGPGMGQNMGPNMGPGMAPNMGAMGSAAPQQHIISVSTSGGGMA
PLGGPPQSPMPPPSSPMGGPSPSPRMQQPPTSPLPVPSPLLSQMSPQLPSPRTPRPPNTH
PLSQLQQQHQMQQMLIKREDGSLGVPHGLRMSPHMAPRPFQQHEQQQHILLHPRFPGQPQ
MPRYLIRQGSDPASQHPPGHPYLQRTGGVHPMMRPPPPYPDHLRKPPPSPAMSPGHGPDG
GDNPDPSRTPPSLSRPNSQPALPSPDPRSSPMERHFSPGTPSSSSSLPQRSPAVPTSLAD
DARGDVGERSVESLSDLLSRVSKTPSESPSPQSRGEEGRPSTGEPSPGRGCGSQDNSGQT
PPLSKQESILQYLRAGSVGSPASNSNSSRGSVDSFAGVAGGQAMCSVAESRATESPHYVP
ASVYQSAGASPVGSPSPSAFAAQSQSMSTGDAFASDGSDSSSPMQVRTQMVRVSQGMMGL
PTTTYVQQIRQQQQQMMLQQSQYVPQQGMAIRRPPAQSPRGSVPFGDSQFVRAQMFRAAA
PANANVARNFVVRPGGNNPPGSGGGLRGGRPHTVGGGRGAVPASPPKASSSSGDEGEGAS
STPSLLHRAGEGGSSSFGGSTFHVGPSSTLVSFETEQMQTSVFVSLDYPAATITSHDGLR
LDEEDGDASRVALVMVGDGDGGQPDAVEHGEPLDVAVVVETVGALSDCDPGDDGSSPGGS
DGADGMAPPGCGELHQRGTPAGDHNYSNPPPEGADEDVAKKLVGRTQFFDGVDVGIKLED
SVLGCISEEKPNIEKLLSERITPPQRASKTPSPPAAPVATSAMSFPASVTHTLNFTLRQT
GMPQTVRLSNDEGQLVVLPGKAMATQLSLSPPAVACEPPVTPKMEPASALTPPAMLRVHA
ALAAPPSSACGSHAAGLRWCRTPPEVKEEGTPSVPPTPPPALPPVVVKQEARSTPSPCLA
ACHKQESEDVEEGSVEAADTGASRLTDGAAVPRTESNSCDDGVPPEQRLALPVTPPVATP
TLPVALMAKDTAAALAAVKVEPTVAAVAVSEAQAGAAEEASAPKACEGSVEGPDGPTGGK
QNVLLKQLLQNCPSAETPHVADLPEGAPTVQTACSGKSENGTGELSQTASLSPSLPSSPS
SQPATTTAETAVTTTAVPASAPVNELDVPATTVGTPESQTVVGVAGTQAGATTTPDTDKP
EESKGSRGGPEEDYELFLEALLGRLRALPPVRILEPLIRPNFNVGVVFGRGDLNLRESSL
KGSYGRAFLPGQPDAYSVCPFGDRPPPPVAPSSAATPSPTPLRGFYNQEFSVHARVTSGG
ADSNRCREADSPDTIVGASSPECAMFEAPFRFRGLQLIDEDSNDSARSLPSPTVPIVAPI
PVKDEKTKEIAFSGDRLPCFSRLAGCGGLLRQTLRDSPNVSVTLTLSSEAATDIRGVLCF
LVKLAADRAPVELRHRGAHEHPSPARSWGSTSTEATVVCHAGRGDHPCREAPDSSRDRLA
RGVAAAREVVRALGEDDEASPAPKEEEGEEEEEEEEGRLLGDLEGSPASEELRKRAPKHS
LALHREQLLDAQDICVKPDKPVEDTRRCILCHVVGDGETNGPARLLNLDVDMWVHLNCAL
WSQEVYETVNGALMNVASACRRAVLLTCCCCQRTGASLRCFRLRCTAAYHFPCAAKDGCS
FFKDKTILCPQHTPRVPNLENVLESVAVFRRVYINRDEHKQVASMIHKGEQNLLRVGSLI
FLSVGQLLPHQLQNFHTPNCIYPVGFKVVRIYWSMHKLGARSRYTCSIHDVDGQPQFQVR
VSSGGHEKILSHRTPKGVWQKVLQPIENFRREAQAIKVFSNFITGEDLFGLTEPAIVRIT
ESLPGVDTLNDYNFRYGRSPLLELPLAINPTGCARSEPKLRTHFKSTEADTAGVHG

BLAST