GenomeNet

>jan:Jann_0903 hypothetical protein; K04097 glutathione S-transferase [EC:2.5.1.18] (A)
MTYDLLIGQQSYSSWSLRAWLAFAPFDIPTTLHKVEIYGDTFYDDVAAFGAVRTVPAVRT
PEGGMLSDSIAIAWHVADAFPDRGVMPSDPVQRAEAMSIIAEMHDGFTALRGACPVNLRT
AWAGFEPSEGVLADVARFEEVMARAINRSGGPFLYGTFTLADAFYAPLATRLLTYGLPMS
STAQAYAKAIVTHPSFVDWRNAGMEETQEIARYDKAPLERVPFPTFA

BLAST