GenomeNet

>jan:Jann_2108 K01805 xylose isomerase [EC:5.3.1.5] | (GenBank) Xylose isomerase-like protein (A)
MSRPNRPRYAARLNAFKQLTPGSDVRDWIAAAGQVGGLGAADLNFPDHFAVYDADQMGNF
LGEAALTLNGIAMRYYTDPGFKLGAFTHPDAAVRQAALDVTKQGIDTCARMGGKTVTLWM
GQDGFDYAFQMDYGLAWDRTVAAIADICAHDPNIDIAIEYKPNEPRAFALMPDIGTTLLA
CREVGAVNLGVTLDFAHVLYADEMPAHSAALIGRHSRMIGLHLNDGYGKRDDGLMVGSVH
AIQTVELLVAMLRMGQTDVIYFDTFPDMGGLNPIEEARTNVAVTDRLMAVAESLMEDPAL
AQAIDRQDAAASHRIVARALYGS

BLAST