GenomeNet

>kaf:KAFR_0B03640 K01580 glutamate decarboxylase [EC:4.1.1.15] | (RefSeq) KAFR0B03640; hypothetical protein (A)
MLHRHSAKHRNPRTVFTHKKSDLPPESKLLSYQEQELEKGKLSGVESVDDARPTLANKYK
IPKQGIEEKYAYQLVHNELTLDGNPHLNLASFVNTYSTDEAKRLITENLNKNLADNDEYP
QLIEITQRCISILSQLWHCDENMEPMGCSTTGSSEAIMLGGLAMKKNWVKKMEKAGKPID
KPNIVMSCACQVALEKFARYFDVECRLVPVSAKSHHMLDPSLLHEYVDENTIGLFVIMGT
TYTGHLEDVEDVSNTLTKLEKEHPEWSNTQIPIHVDGASGGFIVPFAFENSHMKEFGLER
WAFNNPRVVSINTSSHKFGLTTPGLGWVLWKDEAYLPQELRFRLKYLGGVEETFGLNFSR
PGFQVVHQYFNFISKGAAGYRETFRRSLFVARVFSHGLLTSNKLKGCFDIVSSIHEKITD
SSTPKGVNEYWESPSLFKPGVPLVAFKLTKEFQAEYSEIPQVLISSMLRARGWIIPNYPL
PKSTDESDKDEVLRVVFRHEMKLDLAQLLLFDIEMVMQRLVNSYRRVCMHVDKKLTESDE
SKGLRRSFIYDMLLTLASPEGEEISEGDLNAKEDELNKKHKKKQEIRERTSRNYRGTC

BLAST