GenomeNet

>kaf:KAFR_0I02020 K00693 glycogen synthase [EC:2.4.1.11] | (RefSeq) KAFR0I02020; hypothetical protein (A)
MARDLQNNLLFETATEVANRVGGIYSVLKSKAPITAAEYKQNYTLLGPLNKATYQNEVES
VDYNTDLTGELEPIKNSLNAMRSRGVNFIYGNWLIEGSPRVILFDLDSVRGYLNEWKGDL
WSLVGIPSPENDFETNDAILLGYTIAWFLGELTSMDHQHAIIAHFHEWLAGVALPLCRKR
RIDVVTIFTTHATLLGRYLCASGDTDFYNNLEHFDVDQEAGKRGIYHRYCIERAAVHCAD
VFTTVSQITALEAEHLLKRKPDGILPNGLNVVKFQAVHEFQNLHAIKKEKINDFIRGHFH
GSFDFDLDNTLYFFIAGRYEYKNKGVDMFLEALARLNYRLKVSGSKKTVVAFIIMPAKTN
SFTVEALRGQAVVKALETTVNEVTKSIGRRIFDHAMRFPHNGANTEMPTNLDELLKPSDK
VLLKKRVLGLRRPSGQLPPVVTHNMCDDAHDLILNQIRHVQLFNHSYDPVKVIFHPEFLN
ANNPILGLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGAYMEDLIE
TNQAKDYGIYIVDRRFKNPNESVEQLVDYMEEFVKKTRRQRINQRNRTERLSDLLDWKRM
GLEYVKARQLALRRGYPGLFKQLVGEELNDKDMDTLAGGKKLKIARPLSVPGSPRDLRAV
SVSSAVYMTPGDIGTLQEANGADDYFNLAKDDAEEGPYADDNN

BLAST