GenomeNet

>kdi:Krodi_2139 alpha amylase catalytic subunit; K01176 alpha-amylase [EC:3.2.1.1] (A)
MNIKSLVALLLVILSVSSCKEQETALTQVDTQEKNPFFWEAANMYFLLTDRFNNGDTSND
VNFERTQDAAVLRDFMGGDIKGITQKIEDGYFTDLGINAIWFTPVVEQVHGAVDEGTGVT
YGYHGYWTKDWTSLDPNFGTREDLQSLVSAAHQKDIRIVMDVVLNHTGPVTEKDPFWGED
WARENPNCAFSTYENTTACSLVENLPDILTESDQEVALPATLVAKWKSEGRYDEEMAELD
SYFTTNDLKKTPRNYIIKWLTDYIRDFGVDAFRVDTTKHVDEASWVALRAQADKAFADYK
ANNEDKVMDNNDFFMFGEVYNYSIDGGRAYDFGDKKVDYFANGFDNLINFQFKYDAQGSY
EQLFSKYAVIKDSIFSDKSFVNYATSHDDGQPFDKDRNKAIETGTKLLLTTGISQIYYGD
ETARDLTIDGTDGDATLRSFMNWDSINTAPTDEILAHWQKLGTFRRDHPSVGAGTHKMLS
AAPYIFKRSFNKNGMTDTVVVGLDLNIGKKDIVVGNAFAKAQTVKDTYSGQEASIIDGKI
TLDTPYDIVLLEVVKN

BLAST