GenomeNet

>kfl:Kfla_3722 DNA polymerase LigD, polymerase domain-containing protein (A)
MAATKAIELEIAGRTVRVSNPDKPYFADRGLTKLDIVNYFVAVGDGILGALRDRPTTLER
WPGGWFEGAKLSTRMDNKGDAFYQKRVAKGAPDWVETATITFPSGRPADEVCPTELAVVA
WAVNLGTLTFHPWPVRRPELDHPDQLRIDLDPQPGTDFKSAVAVAPALRELLAEHGLEGY
PKTSGGRGLHVYVPIEPRWTFVEARRAVIAVGRELSRRLPEQVTVNWWKEERGERVFIDF
NQMARDRTIASAYSVRPNARARVSAPLRWEELDDVVPDDFDVLTMPARFAEVGDLHAAVG
TQAFSLESLLELSAKHERDHGEGDLPYPPEYPKMPGEPKRVQPSKDRDRPKD

BLAST