GenomeNet

>kfl:Kfla_5280 K01186 sialidase-1 [EC:3.2.1.18] | (GenBank) Laminin G sub domain 2 (A)
MPTPLRLMLALVLVLPALTATTAGARPMAEPAAVVQTVLFDKGGAGYGCYRIPAIVRTKA
GTLLAFAEARRTWCGDSQEIDLVMRRSTDNGRTWSAQKVVLSGTDTDPNAVATRGNPTPI
VDYQTGRIVLLTTMDPGNGTDRPRTPYVQFSEDDGLTFSKARSIGGQIDDPAWGWYATGP
VHGIQLTRGAHQGRLVAGTNYDVSGKHAGQLVYSDDSGETWHKGATDLRSDGLVPQEISV
VEKVDGGIYAGARNNGGSAGNSRAFAVSNDGGESYVAPYAPVVGLTTPTVQGSLVRLRAT
DQGAKYNRILFASPADPERRRYLTIRSSFDEGRTWQTVEQGTRITSDWSGYSDMAVLGTG
EIGLLYEGGTVDARDQIRFARFTETDIGHPDGASGPTTPDVSGLGNHSYLRGGTTAVAGR
FGQARDLDGTDDAIQLPYAESLALGSGDFTAMAWIRYGASTASQAIFWGYGINEFSQFWL
RAEPASSRIRGLITVNGSTAAVASTRAYNDNAWHHVALQRKAGTLSLWVDGAQVGSVAAP
SGSISPGRPFRMYVGQRLDGLHRFDGSLDEVRIYKRALTAAEIASIRTSNVTTVPNVVLD
LPLG

BLAST