GenomeNet

>kla:KLLA0B09394g hypothetical protein; K11482 histone deacetylase HOS1 [EC:3.5.1.98] (A)
MKFIISTSSLQCQIADILPCNNGKKAQLIFALIRAYGLLDYFDHVNDATVATIKDMTKFH
TLDYVKHLLTEEFTYNSTEYIEKEDQVLRLAEVARKFYQDSDVEDDNQVLWFDNEYELFR
YFKEEFNNANSEIDDVSKLDDKDFTKYGLQHDCPKFPFLSMYLQVIVGGTLSLLQHIDHQ
TPSIAINWDGGRHHALKHYASGFCYVNDIVLLIQSLRRKGWKRVTYIDFDLHYGDGVAKA
FRFSENVQTISVHLYEPGFFPGTGSLEETRNSKQMVNLPVLHGMDDKYLLELISSVITPL
IETFNAECIVIQCGSDGLSGDKYNEWQLSIRGLTHAIISIMDMFRDKQVFLLGGGGYNEL
LVSRFYTYLTSKVLELYGNNISSSIPEDDSEVLLRDHEFIELYKDENYRYWSYDNDGEQK
TSLQNDNKKLHIEELKQFYHL

BLAST