GenomeNet

>kla:KLLA0C01155g hypothetical protein; K00844 hexokinase [EC:2.7.1.1] (A)
MSDPKLTKAVDSICDQFIVTKSKISQLTEYFIDCMEKGLEPCESDISQNKGLPMIPTFVT
DKPSGQEHGVTMLAADLGGTNFRVCSVELLGNHEFKIEQEKSKIPTFFFQDDHHVTSKDL
FQHMALITHQFLTKHHKDVIQDYKWKMGFTFSYPVDQTSLSSGKLIRWTKGFKIGDTVGQ
DVVQLFQQELNDIGLSNVHVVALTNDTTGTLLARCYASSDAARAINEPVIGCIFGTGTNG
CYMEKLENIHKLDPASREELLSQGKTHMCINTEWGSFDNELNHLPTTSYDIKIDQQFSTN
PGFHLFEKRVSGLYLGEILRNILLDLEKQELFDLKESVLKNNPFILTTETLSHIEIDTVE
NDLQDTRDALLKAADLETTFEERVLIQKLVRAISRRAAFLAAVPIAAILIKTNALNQSYH
CQVEVGCDGSVVEHYPGFRSMMRHALALSPIGPEGERDVHLRISKDGSGVGAALCALHAN
Y

BLAST