GenomeNet

>kla:KLLA0E22573g K00411 ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:1.10.2.2] | (RefSeq) hypothetical protein (A)
MLGLRNGLKTGLKSVAPARLISTSAVAAKSTYRTPDFGDYIKENNDADKGRSYAYFMVGS
LGLLSSAGAKSTVETFIASMSASADVLAMAKVEVNLAAIPEGKNVVVKWQGKPVFIRHRT
DHEIQEANSVDMSALKDPQTDSDRVQKPEWLVMLGICTHLGCVPIGESGDFGGWFCPCHG
SHYDISGRIRKGPAPLNLEIPQYEFDGENLIVG

BLAST