GenomeNet

>kla:KLLA0F22176g mitochondrial 37S ribosomal protein MRP1; K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] (A)
MLRSSTLKRTFFRSYIVPSFEHLNKDRGLSGLFSKEGLQSAWFDRAEYYTEKLNSYTANT
DEKPLETIIHENANISSKKQIFNYASLLYNLKFSMSSLKGSSLPLPTEKPNRSELLKTPE
LTLTFGNEPLSMGNERLHQALVQSFGSIVEFRSLLLNSNNAISGDGYTWLVARQFKTADP
SAIKFDQLFIVNTYNAGSPFNSNRAGSFKHLQESIKKKTEGFKADKVESAVDAVMYPGTK
YFPLLAIDASPKAWLPDYGVFGKQQYLDSVWESIEWKVVENRLPAFETKAFATL

BLAST