GenomeNet

>kpe:KPK_1501 K00113 glycerol-3-phosphate dehydrogenase subunit C [EC:1.1.5.3] | (GenBank) glpC; glycerol-3-phosphate dehydrogenase, anaerobic, C subunit (A)
MNDTRFESCIKCTVCTTTCPVSRVNPRYPGPKQAGPDGERLRLKDGALYDEALKYCINCK
RCEVACPSDVKIGDIIQRARAQYGQQKPTLRDAILSHTDLMGTLSTPFAPLVNATTGLKP
VRRLLDAALKIDHRRTLPKYGFGTFRRAYRQLAARQAQYPEQVVFFHGCYVNYNHPQLGK
DLIRVVNALGTGVQLLSKEKCCGVPLIANGFFDKARKQAQSNVAAMRENTLPIIATSSTC
TFTLRDEYPHLLDVDNSDLRDRVELATRWIWKQLDAGKTLPLRRLPLKVVYHTPCHMEKM
GWSLYTLELLRLIPGLQLEVLDSQCCGIAGTYGFKTENYAVSQAIGAPLFRQIEESGADI
VVTDCETCKWQIEMSTRKRCEHPLTVLAQALA

BLAST