GenomeNet

>kpn:KPN_02647 K00111 glycerol-3-phosphate dehydrogenase [EC:1.1.5.3] | (GenBank) glpA; sn-glycerol-3-phosphate dehydrogenase (anaerobic), large subunit (A)
MTGRLDSEVIIIGGGATGAGIARDCARRGLRTLLIERHDIATGATGRNQGLLHSGARYAV
TDNESARECISENRILRRIARHCIEPTNGLFITLPEDDLAWQQTFIDACQQAGIEATPLS
PQEALRREPAVNPTLLGAVQVPDGTIDPFRLTAANMLDAREHGAQILTGCEVTGLLRRGD
RVCGVQVYDRQLHQARTLYAGMVVNAAGIWGQRIAEYADLRITMFPAKGSLLILDHRINN
LVINRCRKPADADILVPGDTISLIGTTSMHIPYDEIDDNRVTAAEVDTLLREGEKLAPVM
GRTRILRAYSGVRPLVASDNDPSGRGVSRGIVLLDHAQRDGMEGFITITGGKLMTYRLMA
EWATDAVCRKLGNTTPCTTAEAPLPGSQEPTESTLQKIISLPTPLRGSAVYRHGDRTPSW
LGDSRQHRSLVCECEAVTAGEVKYAVENLAVNTLLDLRRRTRIGMGTCQGELCACRAAGL
LQRFNVTTPAQSLTQLSEFLNERWKGVQPIAWGDALRESEFTRWVYLGLCGLPQEHRDEV

BLAST