GenomeNet

>kpu:KP1_4065 K03564 peroxiredoxin Q/BCP [EC:1.11.1.15] | (GenBank) bcp; bacterioferritin comigratory protein (A)
MTPLKAGDIAPKFSLPDQDGEEVNLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDDL
KKAGVEVLGISTDKPEKLSRFAEKELLNFTLLSDENHQVCEQFGVWGEKSFMGKTYDGIH
RISFLIDADGKIEHVFDDFKTSNHHDVVLNWLKENA

BLAST