GenomeNet

>kse:Ksed_19790 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) DNA ligase D/DNA polymerase LigD (A)
MARSERRTVRVGERTLSVSSLDKVLYPEAGTTKADVVHYYLSVAEVLLPQLAGRPVTRKR
WVDGVGTEGDPGEVFFRKDLEDSAPDWIPTGRIVHANRANSYPLATEAAVLAWFAQVAAL
ELHTPQWRFGPDGQPRRPDRLVLDLDPGEGVGLTECAQVARWCREVLDGMALEAFPVTSG
SKGIHLYAALDGTHDAEAVSAVAHELARALEADHPDLVVSTMKRARRAGKVFLDWSQNNA
SKTTVAPYSLRGRARPTVAAPRTWEELDDPGLAQLELDEVLDRVADGIDPVASLGAGTGP
GGAGEVSSPAPDRLRTYRSMRDPDRTAEPVPADPPREREAPDGELPSFVIQEHHASSLHW
DFRLEHSGVLVSWAVPKGPPLEHDTNRLAVMTEDHPLEYGTFEGTIAAGEYGAGEVTIWD
AGTYERKKWREGKEVIAVLHGRPDGGLGGVPRRFALIQATGMGSERNWLLRLTDEQPGAG
HPQDGSPEEVTAAPSPSRSRADRSDSRTARRALRRRPAPGFTVADLPAAMAATAGTPEQV
ERAVAGGQEWAFEMKWDGYRVVAGVRTAGQGPADADADADAGAEREGAVVLASRNGKDLT
DTFPAAVELTRLLRGEAAERGGAVLDGELVALDDRGRPDFGLLQAALGDGPGVNAAGDPI
ELRYLVFDLLQLGAPGDPEDRQRSLLRIPWGERRELLREVLGTGGDAVSVPPAHTGTLAQ
AQRASRGLGLEGVVAKRVDAVYLPGQRGSAWVKLKTQRHQEVVVIGVRQGRGGRSGGIGS
LLVAVGDDEGELRYAGRVGTGFSAAQLADIEKTLRRIERKTPPVDDVPAADRTDAWWVTP
RLVGEVSLAGRTRDQRVRQAVWRGWRPDKEAGEVRWEV

BLAST