GenomeNet

>ksk:KSE_26470 hypothetical protein; K04565 superoxide dismutase, Cu-Zn family [EC:1.15.1.1] (A)
MPLSSAAGALLVPLALLPVGPPGAQLPAGSGGPVAPGVDRVVDARFDRADGIVPARAITH
APDLVPYGSQVRVTVGRAAGHTSVTVELAGVAGPHEFPAHVHTGSCGADPAASGPHYQQV
PGSDAPDNEVRMTLRTDPGGAGSASATVPWEFRPGEAHSLVLHAGNPAGPHAPGDRAACV
DVDF

BLAST