GenomeNet

>ksk:KSE_54240 tdk; putative thymidine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MAELVFFSGTMDCGKSTLALQMDHNHAARGRQGMIFTRNDRAGAATISSRLGLRADAVEA
GDDFDFQAYVVQLLSAGGKVDYLICDEAQFFSADQIDQLARIVDELGIDVFTFGITTDFR
TRLFPGSQRLIELADRVEVLQVEALCWCGARATHNARTVGGVMVVEGAQVVVGDVTVRED
EIGYEVLCRRHHRRRLTAATARAAVLSPDVLPFEG

BLAST