GenomeNet

>kva:Kvar_1982 Thymidine kinase (EC:2.7.1.21); K00857 thymidine kinase [EC:2.7.1.21] (A)
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTIVYTAEIDDRFGAGKVSSRIGLSSPAR
LYNPQTSLFNDIAAEHKLKPIHCVLVDESQFLTREQVHELSEVVDTLDIPVLCYGLRTDF
RGELFTGSQYLLAWSDKLVELKTICFCGRKASMVLRLDQEGRPYNEGEQVVIGGNERYVS
VCRKHYKEALSVGSLTQVQNQRYSC

BLAST