GenomeNet

>kva:Kvar_2451 K13953 alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1] | (GenBank) Alcohol dehydrogenase zinc-binding domain protein (A)
MKAAVVTHDHQVNVTEKTLRPLEYGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVQKVGPGVTSLKPGDRASVAWFFEGCGHCDYCNSGNETLCRSVKNAGYTVDGGMAEE
CIVTANYAVKVPDGLDSAAASSITCAGVTTYKAVKVSHIKPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDGQLELAASMGADLTINSRNEDAAKVIQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPEAMSLDIPRLVLDGIEVVGSLVGTRQDLVEAFQFAAEG
KVVPKVTLRPLEDINAIFKEMEQGQIRGRMVIDLRS

BLAST