GenomeNet

>kvl:KVU_0371 K00857 thymidine kinase [EC:2.7.1.21] | (RefSeq) tdk; Thymidine kinase (A)
MAKLYFNYSTMNAGKSTVLLQASYNYLERGMQTYLLTAAFDDRAGVGRIESRIGIGADAD
TYRAGDDLFARIRARQAAGEIACVLVDEAQFLTPDQVWQLARAVDDLRVPVMCFGLRVDF
RGELFPGSATLLALADEMREVRTICHCGKKATMVVRYGPDGTVAHDGDQVVIGGNETYVS
LCRRHWRAAMGEDVPF

BLAST